ZYG11A,ZYG11
  • ZYG11A,ZYG11

Anti-ZYG11A Antibody 100ul

Ref: AN-HPA030379-100ul
Anti-ZYG11A

Información del producto

Polyclonal Antibody against Human ZYG11A, Gene description: zyg-11 family member A, cell cycle regulator, Alternative Gene Names: ZYG11, Validated applications: ICC, Uniprot ID: Q6WRX3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZYG11A
Gene Description zyg-11 family member A, cell cycle regulator
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CSREMEVSYFAAGIIAHLTSDRQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWAL
Immunogen CSREMEVSYFAAGIIAHLTSDRQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWAL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ZYG11
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6WRX3
HTS Code 3002150000
Gene ID 440590
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZYG11A Antibody 100ul

Anti-ZYG11A Antibody 100ul