LYRM4,C6orf149
  • LYRM4,C6orf149

Anti-LYRM4 Antibody 25ul

Ref: AN-HPA030362-25ul
Anti-LYRM4

Información del producto

Polyclonal Antibody against Human LYRM4, Gene description: LYR motif containing 4, Alternative Gene Names: C6orf149, CGI-203, ISD11, Validated applications: ICC, IHC, WB, Uniprot ID: Q9HD34, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LYRM4
Gene Description LYR motif containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRD
Immunogen RAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf149, CGI-203, ISD11
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HD34
HTS Code 3002150000
Gene ID 57128
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LYRM4 Antibody 25ul

Anti-LYRM4 Antibody 25ul