RCHY1,ARNIP,CHIMP
  • RCHY1,ARNIP,CHIMP

Anti-RCHY1 Antibody 100ul

Ref: AN-HPA030339-100ul
Anti-RCHY1

Información del producto

Polyclonal Antibody against Human RCHY1, Gene description: ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase, Alternative Gene Names: ARNIP, CHIMP, DKFZp586C1620, PIRH2, PRO1996, RNF199, ZCHY, ZNF363, Validated applications: ICC, IHC, Uniprot ID: Q96PM5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RCHY1
Gene Description ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL
Immunogen CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARNIP, CHIMP, DKFZp586C1620, PIRH2, PRO1996, RNF199, ZCHY, ZNF363
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96PM5
HTS Code 3002150000
Gene ID 25898
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RCHY1 Antibody 100ul

Anti-RCHY1 Antibody 100ul