NCOA7,dJ187J11.3 Ver mas grande

Anti-NCOA7 Antibody 100ul

AN-HPA030291-100ul

Producto nuevo

Anti-NCOA7

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name NCOA7
Gene Description nuclear receptor coactivator 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HGSPTVTKLSKEPSDTSAAFESTAKENFLGEDDDFVDLEELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQS
Immunogen HGSPTVTKLSKEPSDTSAAFESTAKENFLGEDDDFVDLEELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ187J11.3, ERAP140, TLDC4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NI08
HTS Code 3002150000
Gene ID 135112
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human NCOA7, Gene description: nuclear receptor coactivator 7, Alternative Gene Names: dJ187J11.3, ERAP140, TLDC4, Validated applications: IHC, Uniprot ID: Q8NI08, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image