UFD1L,UFD1
  • UFD1L,UFD1

Anti-UFD1L Antibody 100ul

Ref: AN-HPA030287-100ul
Anti-UFD1L

Información del producto

Polyclonal Antibody against Human UFD1L, Gene description: ubiquitin fusion degradation 1 like (yeast), Alternative Gene Names: UFD1, Validated applications: IHC, WB, Uniprot ID: Q92890, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UFD1L
Gene Description ubiquitin fusion degradation 1 like (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence QVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLG
Immunogen QVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names UFD1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92890
HTS Code 3002150000
Gene ID 7353
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UFD1L Antibody 100ul

Anti-UFD1L Antibody 100ul