FRS3,FRS2B,FRS2beta
  • FRS3,FRS2B,FRS2beta

Anti-FRS3 Antibody 25ul

Ref: AN-HPA030174-25ul
Anti-FRS3

Información del producto

Polyclonal Antibody against Human FRS3, Gene description: fibroblast growth factor receptor substrate 3, Alternative Gene Names: FRS2B, FRS2beta, SNT-2, Validated applications: IHC, WB, Uniprot ID: O43559, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FRS3
Gene Description fibroblast growth factor receptor substrate 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC
Sequence GAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLT
Immunogen GAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FRS2B, FRS2beta, SNT-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43559
HTS Code 3002150000
Gene ID 10817
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FRS3 Antibody 25ul

Anti-FRS3 Antibody 25ul