CEP162,C6orf84
  • CEP162,C6orf84

Anti-CEP162 Antibody 100ul

Ref: AN-HPA030173-100ul
Anti-CEP162

Información del producto

Polyclonal Antibody against Human CEP162, Gene description: centrosomal protein 162kDa, Alternative Gene Names: C6orf84, KIAA1009, QN1, Validated applications: IHC, Uniprot ID: Q5TB80, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CEP162
Gene Description centrosomal protein 162kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EVASLKEQMHKSRFLSQVVEDSEPTRNQNFTDLLAELRMAQKEKDSLLEDIKRLKQDKQALEVDFEKMKKERDQAKDQIAYVTGEKLYEIKILEETHKQEISRLQ
Immunogen EVASLKEQMHKSRFLSQVVEDSEPTRNQNFTDLLAELRMAQKEKDSLLEDIKRLKQDKQALEVDFEKMKKERDQAKDQIAYVTGEKLYEIKILEETHKQEISRLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf84, KIAA1009, QN1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5TB80
HTS Code 3002150000
Gene ID 22832
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CEP162 Antibody 100ul

Anti-CEP162 Antibody 100ul