RWDD2A,dJ747H23.2
  • RWDD2A,dJ747H23.2

Anti-RWDD2A Antibody 100ul

Ref: AN-HPA030105-100ul
Anti-RWDD2A

Información del producto

Polyclonal Antibody against Human RWDD2A, Gene description: RWD domain containing 2A, Alternative Gene Names: dJ747H23.2, MGC13523, RWDD2, Validated applications: IHC, WB, Uniprot ID: Q9UIY3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RWDD2A
Gene Description RWD domain containing 2A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence QLLLNKGLTSYIGTFDPGELCVCAAIQWLQDNSASYFLNRKLVYEPSTQAKPVKNTFLRMWIYSHHIYQQDLRKKILDVGKRLDVTGFCM
Immunogen QLLLNKGLTSYIGTFDPGELCVCAAIQWLQDNSASYFLNRKLVYEPSTQAKPVKNTFLRMWIYSHHIYQQDLRKKILDVGKRLDVTGFCM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ747H23.2, MGC13523, RWDD2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UIY3
HTS Code 3002150000
Gene ID 112611
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RWDD2A Antibody 100ul

Anti-RWDD2A Antibody 100ul