KCTD20,C6orf69
  • KCTD20,C6orf69

Anti-KCTD20 Antibody 25ul

Ref: AN-HPA030092-25ul
Anti-KCTD20

Información del producto

Polyclonal Antibody against Human KCTD20, Gene description: potassium channel tetramerization domain containing 20, Alternative Gene Names: C6orf69, dJ108K11.3, MGC14254, Validated applications: ICC, IHC, Uniprot ID: Q7Z5Y7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KCTD20
Gene Description potassium channel tetramerization domain containing 20
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
Immunogen LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf69, dJ108K11.3, MGC14254
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z5Y7
HTS Code 3002150000
Gene ID 222658
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KCTD20 Antibody 25ul

Anti-KCTD20 Antibody 25ul