MAP3K7CL,C21orf7
  • MAP3K7CL,C21orf7

Anti-MAP3K7CL Antibody 25ul

Ref: AN-HPA030079-25ul
Anti-MAP3K7CL

Información del producto

Polyclonal Antibody against Human MAP3K7CL, Gene description: MAP3K7 C-terminal like, Alternative Gene Names: C21orf7, TAK1L, TAKL, TAKL-1, TAKL-2, TAKL-4, Validated applications: ICC, Uniprot ID: P57077, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAP3K7CL
Gene Description MAP3K7 C-terminal like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGS
Immunogen AEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C21orf7, TAK1L, TAKL, TAKL-1, TAKL-2, TAKL-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P57077
HTS Code 3002150000
Gene ID 56911
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAP3K7CL Antibody 25ul

Anti-MAP3K7CL Antibody 25ul