RD3,C1orf36,LCA12
  • RD3,C1orf36,LCA12

Anti-RD3 Antibody 100ul

Ref: AN-HPA029943-100ul
Anti-RD3

Información del producto

Polyclonal Antibody against Human RD3, Gene description: retinal degeneration 3, Alternative Gene Names: C1orf36, LCA12, Validated applications: IHC, Uniprot ID: Q7Z3Z2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RD3
Gene Description retinal degeneration 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RSTYDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMK
Immunogen RSTYDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf36, LCA12
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z3Z2
HTS Code 3002150000
Gene ID 343035
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RD3 Antibody 100ul

Anti-RD3 Antibody 100ul