EGR1,AT225,G0S30
  • EGR1,AT225,G0S30

Anti-EGR1 Antibody 100ul

Ref: AN-HPA029938-100ul
Anti-EGR1

Información del producto

Polyclonal Antibody against Human EGR1, Gene description: early growth response 1, Alternative Gene Names: AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225, Validated applications: ICC, Uniprot ID: P18146, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EGR1
Gene Description early growth response 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLI
Immunogen IFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P18146
HTS Code 3002150000
Gene ID 1958
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EGR1 Antibody 100ul

Anti-EGR1 Antibody 100ul