WRAP53,FLJ10385
  • WRAP53,FLJ10385

Anti-WRAP53 Antibody 25ul

Ref: AN-HPA029928-25ul
Anti-WRAP53

Información del producto

Polyclonal Antibody against Human WRAP53, Gene description: WD repeat containing, antisense to TP53, Alternative Gene Names: FLJ10385, TCAB1, WDR79, Validated applications: ICC, Uniprot ID: Q9BUR4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WRAP53
Gene Description WD repeat containing, antisense to TP53
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT
Immunogen MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10385, TCAB1, WDR79
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BUR4
HTS Code 3002150000
Gene ID 55135
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WRAP53 Antibody 25ul

Anti-WRAP53 Antibody 25ul