RRP36,C6orf153
  • RRP36,C6orf153

Anti-RRP36 Antibody 100ul

Ref: AN-HPA029904-100ul
Anti-RRP36

Información del producto

Polyclonal Antibody against Human RRP36, Gene description: ribosomal RNA processing 36 homolog (S. cerevisiae), Alternative Gene Names: C6orf153, dJ20C7.4, Validated applications: IHC, WB, Uniprot ID: Q96EU6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RRP36
Gene Description ribosomal RNA processing 36 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQ
Immunogen NACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf153, dJ20C7.4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EU6
HTS Code 3002150000
Gene ID 88745
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RRP36 Antibody 100ul

Anti-RRP36 Antibody 100ul