MRPL10,L10MT
  • MRPL10,L10MT

Anti-MRPL10 Antibody 100ul

Ref: AN-HPA029885-100ul
Anti-MRPL10

Información del producto

Polyclonal Antibody against Human MRPL10, Gene description: mitochondrial ribosomal protein L10, Alternative Gene Names: L10MT, MGC17973, MRP-L10, MRP-L8, MRPL8, RPML8, Validated applications: ICC, WB, Uniprot ID: Q7Z7H8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL10
Gene Description mitochondrial ribosomal protein L10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence RLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRREIAAVFQDNRMIAVCQ
Immunogen RLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRREIAAVFQDNRMIAVCQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names L10MT, MGC17973, MRP-L10, MRP-L8, MRPL8, RPML8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7H8
HTS Code 3002150000
Gene ID 124995
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPL10 Antibody 100ul

Anti-MRPL10 Antibody 100ul