PNRC1,B4-2,PROL2
  • PNRC1,B4-2,PROL2

Anti-PNRC1 Antibody 25ul

Ref: AN-HPA029839-25ul
Anti-PNRC1

Información del producto

Polyclonal Antibody against Human PNRC1, Gene description: proline-rich nuclear receptor coactivator 1, Alternative Gene Names: B4-2, PROL2, PRR2, Validated applications: IHC, WB, Uniprot ID: Q12796, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PNRC1
Gene Description proline-rich nuclear receptor coactivator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK
Immunogen QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B4-2, PROL2, PRR2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12796
HTS Code 3002150000
Gene ID 10957
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PNRC1 Antibody 25ul

Anti-PNRC1 Antibody 25ul