HBS1L,DKFZp434g247
  • HBS1L,DKFZp434g247

Anti-HBS1L Antibody 100ul

Ref: AN-HPA029728-100ul
Anti-HBS1L

Información del producto

Polyclonal Antibody against Human HBS1L, Gene description: HBS1-like translational GTPase, Alternative Gene Names: DKFZp434g247, EF-1a, eRF3c, ERFS, HBS1, HSPC276, KIAA1038, Validated applications: ICC, Uniprot ID: Q9Y450, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HBS1L
Gene Description HBS1-like translational GTPase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF
Immunogen CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434g247, EF-1a, eRF3c, ERFS, HBS1, HSPC276, KIAA1038
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y450
HTS Code 3002150000
Gene ID 10767
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HBS1L Antibody 100ul

Anti-HBS1L Antibody 100ul