RAD23B,HHR23B,HR23B
  • RAD23B,HHR23B,HR23B

Anti-RAD23B Antibody 25ul

Ref: AN-HPA029718-25ul
Anti-RAD23B

Información del producto

Polyclonal Antibody against Human RAD23B, Gene description: RAD23 homolog B (S. cerevisiae), Alternative Gene Names: HHR23B, HR23B, P58, Validated applications: ICC, IHC, WB, Uniprot ID: P54727, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RAD23B
Gene Description RAD23 homolog B (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence VIEALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNP
Immunogen VIEALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HHR23B, HR23B, P58
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P54727
HTS Code 3002150000
Gene ID 5887
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAD23B Antibody 25ul

Anti-RAD23B Antibody 25ul