TYW3,C1orf171
  • TYW3,C1orf171

Anti-TYW3 Antibody 100ul

Ref: AN-HPA029641-100ul
Anti-TYW3

Información del producto

Polyclonal Antibody against Human TYW3, Gene description: tRNA-yW synthesizing protein 3 homolog (S. cerevisiae), Alternative Gene Names: C1orf171, FLJ40918, Validated applications: ICC, IHC, WB, Uniprot ID: Q6IPR3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TYW3
Gene Description tRNA-yW synthesizing protein 3 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence EFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIV
Immunogen EFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf171, FLJ40918
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IPR3
HTS Code 3002150000
Gene ID 127253
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TYW3 Antibody 100ul

Anti-TYW3 Antibody 100ul