IL1R1,CD121A
  • IL1R1,CD121A

Anti-IL1R1 Antibody 100ul

Ref: AN-HPA029560-100ul
Anti-IL1R1

Información del producto

Polyclonal Antibody against Human IL1R1, Gene description: interleukin 1 receptor, type I, Alternative Gene Names: CD121A, D2S1473, IL1R, IL1RA, Validated applications: IHC, Uniprot ID: P14778, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IL1R1
Gene Description interleukin 1 receptor, type I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLF
Immunogen VLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD121A, D2S1473, IL1R, IL1RA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P14778
HTS Code 3002150000
Gene ID 3554
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IL1R1 Antibody 100ul

Anti-IL1R1 Antibody 100ul