ZNF655,VIK,VIK-1
  • ZNF655,VIK,VIK-1

Anti-ZNF655 Antibody 25ul

Ref: AN-HPA029534-25ul
Anti-ZNF655

Información del producto

Polyclonal Antibody against Human ZNF655, Gene description: zinc finger protein 655, Alternative Gene Names: VIK, VIK-1, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N720, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF655
Gene Description zinc finger protein 655
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence TDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRI
Immunogen TDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names VIK, VIK-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N720
HTS Code 3002150000
Gene ID 79027
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF655 Antibody 25ul

Anti-ZNF655 Antibody 25ul