LRRC25,FLJ38116,MAPA
  • LRRC25,FLJ38116,MAPA

Anti-LRRC25 Antibody 25ul

Ref: AN-HPA029459-25ul
Anti-LRRC25

Información del producto

Polyclonal Antibody against Human LRRC25, Gene description: leucine rich repeat containing 25, Alternative Gene Names: FLJ38116, MAPA, Validated applications: IHC, WB, Uniprot ID: Q8N386, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LRRC25
Gene Description leucine rich repeat containing 25
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence EPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSA
Immunogen EPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ38116, MAPA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N386
HTS Code 3002150000
Gene ID 126364
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LRRC25 Antibody 25ul

Anti-LRRC25 Antibody 25ul