TFB1M,CGI-75,mtTFB
  • TFB1M,CGI-75,mtTFB

Anti-TFB1M Antibody 100ul

Ref: AN-HPA029428-100ul
Anti-TFB1M

Información del producto

Polyclonal Antibody against Human TFB1M, Gene description: transcription factor B1, mitochondrial, Alternative Gene Names: CGI-75, mtTFB, Validated applications: IHC, WB, Uniprot ID: Q8WVM0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TFB1M
Gene Description transcription factor B1, mitochondrial
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence QRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQPFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISHFKSLCDVYRKMCDEDPQL
Immunogen QRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQPFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISHFKSLCDVYRKMCDEDPQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-75, mtTFB
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVM0
HTS Code 3002150000
Gene ID 51106
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TFB1M Antibody 100ul

Anti-TFB1M Antibody 100ul