FAM189A2,C9orf61
  • FAM189A2,C9orf61

Anti-FAM189A2 Antibody 25ul

Ref: AN-HPA029411-25ul
Anti-FAM189A2

Información del producto

Polyclonal Antibody against Human FAM189A2, Gene description: family with sequence similarity 189, member A2, Alternative Gene Names: C9orf61, X123, Validated applications: IHC, WB, Uniprot ID: Q15884, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM189A2
Gene Description family with sequence similarity 189, member A2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFL
Immunogen PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf61, X123
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15884
HTS Code 3002150000
Gene ID 9413
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM189A2 Antibody 25ul

Anti-FAM189A2 Antibody 25ul