SMG7,C1orf16,EST1C
  • SMG7,C1orf16,EST1C

Anti-SMG7 Antibody 100ul

Ref: AN-HPA029350-100ul
Anti-SMG7

Información del producto

Polyclonal Antibody against Human SMG7, Gene description: SMG7 nonsense mediated mRNA decay factor, Alternative Gene Names: C1orf16, EST1C, KIAA0250, SGA56M, SMG-7, Validated applications: ICC, IHC, Uniprot ID: Q92540, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SMG7
Gene Description SMG7 nonsense mediated mRNA decay factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFELQGFLALRPSFRNLDFSKGHQGI
Immunogen RDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFELQGFLALRPSFRNLDFSKGHQGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf16, EST1C, KIAA0250, SGA56M, SMG-7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92540
HTS Code 3002150000
Gene ID 9887
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SMG7 Antibody 100ul

Anti-SMG7 Antibody 100ul