LMO2,RBTN2,RBTNL1
  • LMO2,RBTN2,RBTNL1

Anti-LMO2 Antibody 100ul

Ref: AN-HPA029285-100ul
Anti-LMO2

Información del producto

Polyclonal Antibody against Human LMO2, Gene description: LIM domain only 2 (rhombotin-like 1), Alternative Gene Names: RBTN2, RBTNL1, RHOM2, TTG2, Validated applications: ICC, Uniprot ID: P25791, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LMO2
Gene Description LIM domain only 2 (rhombotin-like 1)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM
Immunogen KSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RBTN2, RBTNL1, RHOM2, TTG2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P25791
HTS Code 3002150000
Gene ID 4005
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LMO2 Antibody 100ul

Anti-LMO2 Antibody 100ul