KIF13A,bA500C11.2
  • KIF13A,bA500C11.2

Anti-KIF13A Antibody 100ul

Ref: AN-HPA029253-100ul
Anti-KIF13A

Información del producto

Polyclonal Antibody against Human KIF13A, Gene description: kinesin family member 13A, Alternative Gene Names: bA500C11.2, Validated applications: IHC, Uniprot ID: Q9H1H9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KIF13A
Gene Description kinesin family member 13A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TGLPLNLSNFVFCQYTFWDQCESTVAAPVVDPEVPSPQSKDAQYTVTFSHCKDYVVNVTEEFLEFISDGALAIEVWGHRCAGNGSSIWEVDSLHAK
Immunogen TGLPLNLSNFVFCQYTFWDQCESTVAAPVVDPEVPSPQSKDAQYTVTFSHCKDYVVNVTEEFLEFISDGALAIEVWGHRCAGNGSSIWEVDSLHAK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA500C11.2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H1H9
HTS Code 3002150000
Gene ID 63971
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KIF13A Antibody 100ul

Anti-KIF13A Antibody 100ul