NFKBIA,IkappaBalpha
  • NFKBIA,IkappaBalpha

Anti-NFKBIA Antibody 25ul

Ref: AN-HPA029207-25ul
Anti-NFKBIA

Información del producto

Polyclonal Antibody against Human NFKBIA, Gene description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha, Alternative Gene Names: IkappaBalpha, IKBA, MAD-3, NFKBI, Validated applications: ICC, IHC, WB, Uniprot ID: P25963, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NFKBIA
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG
Immunogen MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IkappaBalpha, IKBA, MAD-3, NFKBI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P25963
HTS Code 3002150000
Gene ID 4792
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NFKBIA Antibody 25ul

Anti-NFKBIA Antibody 25ul