SERPINH1,CBP1,CBP2
  • SERPINH1,CBP1,CBP2

Anti-SERPINH1 Antibody 100ul

Ref: AN-HPA029198-100ul
Anti-SERPINH1

Información del producto

Polyclonal Antibody against Human SERPINH1, Gene description: serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1), Alternative Gene Names: CBP1, CBP2, colligen, HSP47, SERPINH2, Validated applications: ICC, IHC, WB, Uniprot ID: P50454, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SERPINH1
Gene Description serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, ICC, WB
Sequence LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
Immunogen LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CBP1, CBP2, colligen, HSP47, SERPINH2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P50454
HTS Code 3002150000
Gene ID 871
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SERPINH1 Antibody 100ul

Anti-SERPINH1 Antibody 100ul