ICOSLG,B7-H2,B7H2
  • ICOSLG,B7-H2,B7H2

Anti-ICOSLG Antibody 100ul

Ref: AN-HPA029179-100ul
Anti-ICOSLG

Información del producto

Polyclonal Antibody against Human ICOSLG, Gene description: inducible T-cell costimulator ligand, Alternative Gene Names: B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, Validated applications: ICC, Uniprot ID: O75144, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ICOSLG
Gene Description inducible T-cell costimulator ligand
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT
Immunogen KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75144
HTS Code 3002150000
Gene ID 23308
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ICOSLG Antibody 100ul

Anti-ICOSLG Antibody 100ul