NT5C3A,cN-III,hUMP1
  • NT5C3A,cN-III,hUMP1

Anti-NT5C3A Antibody 100ul

Ref: AN-HPA029058-100ul
Anti-NT5C3A

Información del producto

Polyclonal Antibody against Human NT5C3A, Gene description: 5'-nucleotidase, cytosolic IIIA, Alternative Gene Names: cN-III, hUMP1, NT5C3, p36, P5'N-1, PN-I, POMP, PSN1, UMPH, UMPH1, Validated applications: IHC, WB, Uniprot ID: Q9H0P0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NT5C3A
Gene Description 5'-nucleotidase, cytosolic IIIA
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGY
Immunogen RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cN-III, hUMP1, NT5C3, p36, P5'N-1, PN-I, POMP, PSN1, UMPH, UMPH1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0P0
HTS Code 3002150000
Gene ID 51251
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NT5C3A Antibody 100ul

Anti-NT5C3A Antibody 100ul