SRSF6,B52,SFRS6
  • SRSF6,B52,SFRS6

Anti-SRSF6 Antibody 100ul

Ref: AN-HPA029005-100ul
Anti-SRSF6

Información del producto

Polyclonal Antibody against Human SRSF6, Gene description: serine/arginine-rich splicing factor 6, Alternative Gene Names: B52, SFRS6, SRP55, Validated applications: IHC, WB, Uniprot ID: Q13247, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SRSF6
Gene Description serine/arginine-rich splicing factor 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, IHC
Sequence KDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSR
Immunogen KDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B52, SFRS6, SRP55
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13247
HTS Code 3002150000
Gene ID 6431
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SRSF6 Antibody 100ul

Anti-SRSF6 Antibody 100ul