BUD31,Cwc14,EDG-2
  • BUD31,Cwc14,EDG-2

Anti-BUD31 Antibody 100ul

Ref: AN-HPA028943-100ul
Anti-BUD31

Información del producto

Polyclonal Antibody against Human BUD31, Gene description: BUD31 homolog (S. cerevisiae), Alternative Gene Names: Cwc14, EDG-2, EDG2, fSAP17, G10, YCR063W, Validated applications: ICC, IHC, WB, Uniprot ID: P41223, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BUD31
Gene Description BUD31 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, ICC, WB
Sequence DGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIE
Immunogen DGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cwc14, EDG-2, EDG2, fSAP17, G10, YCR063W
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P41223
HTS Code 3002150000
Gene ID 8896
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-BUD31 Antibody 100ul

Anti-BUD31 Antibody 100ul