AKAP10,D-AKAP2
  • AKAP10,D-AKAP2

Anti-AKAP10 Antibody 25ul

Ref: AN-HPA028901-25ul
Anti-AKAP10

Información del producto

Polyclonal Antibody against Human AKAP10, Gene description: A kinase (PRKA) anchor protein 10, Alternative Gene Names: D-AKAP2, MGC9414, PRKA10, Validated applications: ICC, IHC, WB, Uniprot ID: O43572, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AKAP10
Gene Description A kinase (PRKA) anchor protein 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence SAQLFMTHSEGIDLNNRTNSTQNHLLLSQECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFV
Immunogen SAQLFMTHSEGIDLNNRTNSTQNHLLLSQECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D-AKAP2, MGC9414, PRKA10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43572
HTS Code 3002150000
Gene ID 11216
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AKAP10 Antibody 25ul

Anti-AKAP10 Antibody 25ul