NAP1L1,MGC23410
  • NAP1L1,MGC23410

Anti-NAP1L1 Antibody 100ul

Ref: AN-HPA028861-100ul
Anti-NAP1L1

Información del producto

Polyclonal Antibody against Human NAP1L1, Gene description: nucleosome assembly protein 1-like 1, Alternative Gene Names: MGC23410, MGC8688, NAP1, NAP1L, NRP, Validated applications: IHC, WB, Uniprot ID: P55209, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NAP1L1
Gene Description nucleosome assembly protein 1-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK
Immunogen MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC23410, MGC8688, NAP1, NAP1L, NRP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55209
HTS Code 3002150000
Gene ID 4673
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NAP1L1 Antibody 100ul

Anti-NAP1L1 Antibody 100ul