P2RX6,MGC129625
  • P2RX6,MGC129625

Anti-P2RX6 Antibody 25ul

Ref: AN-HPA028777-25ul
Anti-P2RX6

Información del producto

Polyclonal Antibody against Human P2RX6, Gene description: purinergic receptor P2X, ligand-gated ion channel, 6, Alternative Gene Names: MGC129625, P2RXL1, P2X6, P2XM, Validated applications: IHC, Uniprot ID: O15547, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name P2RX6
Gene Description purinergic receptor P2X, ligand-gated ion channel, 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLAN
Immunogen VTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLAN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC129625, P2RXL1, P2X6, P2XM
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15547
HTS Code 3002150000
Gene ID 9127
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-P2RX6 Antibody 25ul

Anti-P2RX6 Antibody 25ul