GARNL3,bA356B19.1
  • GARNL3,bA356B19.1

Anti-GARNL3 Antibody 25ul

Ref: AN-HPA028757-25ul
Anti-GARNL3

Información del producto

Polyclonal Antibody against Human GARNL3, Gene description: GTPase activating Rap/RanGAP domain-like 3, Alternative Gene Names: bA356B19.1, DKFZp761J1523, Validated applications: ICC, IHC, WB, Uniprot ID: Q5VVW2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GARNL3
Gene Description GTPase activating Rap/RanGAP domain-like 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTP
Immunogen LVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA356B19.1, DKFZp761J1523
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VVW2
HTS Code 3002150000
Gene ID 84253
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GARNL3 Antibody 25ul

Anti-GARNL3 Antibody 25ul