TP53I3,PIG3 Ver mas grande

Anti-TP53I3 Antibody 25ul

AN-HPA028742-25ul

Producto nuevo

Anti-TP53I3

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name TP53I3
Gene Description tumor protein p53 inducible protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL
Immunogen GRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PIG3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q53FA7
HTS Code 3002150000
Gene ID 9540
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación IHC, WB
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human TP53I3, Gene description: tumor protein p53 inducible protein 3, Alternative Gene Names: PIG3, Validated applications: IHC, WB, Uniprot ID: Q53FA7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image