TP53I3,PIG3
  • TP53I3,PIG3

Anti-TP53I3 Antibody 100ul

Ref: AN-HPA028742-100ul
Anti-TP53I3

Información del producto

Polyclonal Antibody against Human TP53I3, Gene description: tumor protein p53 inducible protein 3, Alternative Gene Names: PIG3, Validated applications: IHC, WB, Uniprot ID: Q53FA7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TP53I3
Gene Description tumor protein p53 inducible protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL
Immunogen GRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PIG3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q53FA7
HTS Code 3002150000
Gene ID 9540
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TP53I3 Antibody 100ul

Anti-TP53I3 Antibody 100ul