IPCEF1,KIAA0403
  • IPCEF1,KIAA0403

Anti-IPCEF1 Antibody 100ul

Ref: AN-HPA028710-100ul
Anti-IPCEF1

Información del producto

Polyclonal Antibody against Human IPCEF1, Gene description: interaction protein for cytohesin exchange factors 1, Alternative Gene Names: KIAA0403, PIP3-E, Validated applications: ICC, Uniprot ID: Q8WWN9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IPCEF1
Gene Description interaction protein for cytohesin exchange factors 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET
Immunogen VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0403, PIP3-E
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWN9
HTS Code 3002150000
Gene ID 26034
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IPCEF1 Antibody 100ul

Anti-IPCEF1 Antibody 100ul