RAB11FIP3,eferin
  • RAB11FIP3,eferin

Anti-RAB11FIP3 Antibody 100ul

Ref: AN-HPA028631-100ul
Anti-RAB11FIP3

Información del producto

Polyclonal Antibody against Human RAB11FIP3, Gene description: RAB11 family interacting protein 3 (class II), Alternative Gene Names: eferin, KIAA0665, Rab11-FIP3, Validated applications: IHC, Uniprot ID: O75154, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAB11FIP3
Gene Description RAB11 family interacting protein 3 (class II)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ
Immunogen PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eferin, KIAA0665, Rab11-FIP3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75154
HTS Code 3002150000
Gene ID 9727
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAB11FIP3 Antibody 100ul

Anti-RAB11FIP3 Antibody 100ul