CCDC28B,MGC1203
  • CCDC28B,MGC1203

Anti-CCDC28B Antibody 100ul

Ref: AN-HPA028589-100ul
Anti-CCDC28B

Información del producto

Polyclonal Antibody against Human CCDC28B, Gene description: coiled-coil domain containing 28B, Alternative Gene Names: MGC1203, RP4-622L5.5, Validated applications: IHC, Uniprot ID: Q9BUN5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC28B
Gene Description coiled-coil domain containing 28B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LEDLSNSMYPFQGTRLCVCVPERSVSSSPALQEYSHTTNFPTSCSPVRFSHRLPKPRYRNLEFP
Immunogen LEDLSNSMYPFQGTRLCVCVPERSVSSSPALQEYSHTTNFPTSCSPVRFSHRLPKPRYRNLEFP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC1203, RP4-622L5.5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BUN5
HTS Code 3002150000
Gene ID 79140
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC28B Antibody 100ul

Anti-CCDC28B Antibody 100ul