DIRAS3,ARHI,NOEY2
  • DIRAS3,ARHI,NOEY2

Anti-DIRAS3 Antibody 100ul

Ref: AN-HPA028483-100ul
Anti-DIRAS3

Información del producto

Polyclonal Antibody against Human DIRAS3, Gene description: DIRAS family, GTP-binding RAS-like 3, Alternative Gene Names: ARHI, NOEY2, Validated applications: IHC, WB, Uniprot ID: O95661, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DIRAS3
Gene Description DIRAS family, GTP-binding RAS-like 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Immunogen SDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARHI, NOEY2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95661
HTS Code 3002150000
Gene ID 9077
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DIRAS3 Antibody 100ul

Anti-DIRAS3 Antibody 100ul