EXOSC10,p2,p3,p4
  • EXOSC10,p2,p3,p4

Anti-EXOSC10 Antibody 100ul

Ref: AN-HPA028470-100ul
Anti-EXOSC10

Información del producto

Polyclonal Antibody against Human EXOSC10, Gene description: exosome component 10, Alternative Gene Names: p2, p3, p4, PM-Scl, PM/Scl-100, PMSCL2, RRP6, Rrp6p, Validated applications: IHC, WB, Uniprot ID: Q01780, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EXOSC10
Gene Description exosome component 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA
Immunogen KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p2, p3, p4, PM-Scl, PM/Scl-100, PMSCL2, RRP6, Rrp6p
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q01780
HTS Code 3002150000
Gene ID 5394
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EXOSC10 Antibody 100ul

Anti-EXOSC10 Antibody 100ul