C1orf131
  • C1orf131

Anti-C1orf131 Antibody 100ul

Ref: AN-HPA028452-100ul
Anti-C1orf131

Información del producto

Polyclonal Antibody against Human C1orf131, Gene description: chromosome 1 open reading frame 131, Alternative Gene Names: DKFZp547B1713, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NDD1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1orf131
Gene Description chromosome 1 open reading frame 131
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence ADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGS
Immunogen ADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp547B1713
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NDD1
HTS Code 3002150000
Gene ID 128061
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C1orf131 Antibody 100ul

Anti-C1orf131 Antibody 100ul