YOD1,DKFZp451J1719
  • YOD1,DKFZp451J1719

Anti-YOD1 Antibody 100ul

Ref: AN-HPA028400-100ul
Anti-YOD1

Información del producto

Polyclonal Antibody against Human YOD1, Gene description: YOD1 deubiquitinase, Alternative Gene Names: DKFZp451J1719, DUBA8, OTUD2, Validated applications: ICC, IHC, WB, Uniprot ID: Q5VVQ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name YOD1
Gene Description YOD1 deubiquitinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA
Immunogen DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp451J1719, DUBA8, OTUD2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VVQ6
HTS Code 3002150000
Gene ID 55432
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-YOD1 Antibody 100ul

Anti-YOD1 Antibody 100ul