MAF,c-MAF
  • MAF,c-MAF

Anti-MAF Antibody 25ul

Ref: AN-HPA028289-25ul
Anti-MAF

Información del producto

Polyclonal Antibody against Human MAF, Gene description: v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog, Alternative Gene Names: c-MAF, Validated applications: IHC, Uniprot ID: O75444, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAF
Gene Description v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPED
Immunogen MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-MAF
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75444
HTS Code 3002150000
Gene ID 4094
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAF Antibody 25ul

Anti-MAF Antibody 25ul