SASS6,DKFZp761A078
  • SASS6,DKFZp761A078

Anti-SASS6 Antibody 25ul

Ref: AN-HPA028187-25ul
Anti-SASS6

Información del producto

Polyclonal Antibody against Human SASS6, Gene description: spindle assembly 6 homolog (C. elegans), Alternative Gene Names: DKFZp761A078, FLJ22097, SAS-6, SAS6, Validated applications: ICC, IHC, Uniprot ID: Q6UVJ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SASS6
Gene Description spindle assembly 6 homolog (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLITWLNKELNENQLVRKQDVLGPSTTPPAHSSSNTIRSGISPNL
Immunogen QKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLITWLNKELNENQLVRKQDVLGPSTTPPAHSSSNTIRSGISPNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp761A078, FLJ22097, SAS-6, SAS6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UVJ0
HTS Code 3002150000
Gene ID 163786
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SASS6 Antibody 25ul

Anti-SASS6 Antibody 25ul