SNAP47,C1orf142
  • SNAP47,C1orf142

Anti-SNAP47 Antibody 100ul

Ref: AN-HPA028167-100ul
Anti-SNAP47

Información del producto

Polyclonal Antibody against Human SNAP47, Gene description: synaptosomal-associated protein, 47kDa, Alternative Gene Names: C1orf142, SNAP-47, SVAP1, Validated applications: ICC, IHC, Uniprot ID: Q5SQN1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNAP47
Gene Description synaptosomal-associated protein, 47kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DDIKVHSPYEISIRQRFIGKPDMAYRLISAKMPEVIPILEVQFSKKMELLEDALVLRSARTSSPAEKSCSVWHAASGLMGRTLHREPPAGDQE
Immunogen DDIKVHSPYEISIRQRFIGKPDMAYRLISAKMPEVIPILEVQFSKKMELLEDALVLRSARTSSPAEKSCSVWHAASGLMGRTLHREPPAGDQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf142, SNAP-47, SVAP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SQN1
HTS Code 3002150000
Gene ID 116841
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SNAP47 Antibody 100ul

Anti-SNAP47 Antibody 100ul