ARHGEF10L,FLJ10521
  • ARHGEF10L,FLJ10521

Anti-ARHGEF10L Antibody 25ul

Ref: AN-HPA028115-25ul
Anti-ARHGEF10L

Información del producto

Polyclonal Antibody against Human ARHGEF10L, Gene description: Rho guanine nucleotide exchange factor (GEF) 10-like, Alternative Gene Names: FLJ10521, KIAA1626, Validated applications: ICC, IHC, Uniprot ID: Q9HCE6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARHGEF10L
Gene Description Rho guanine nucleotide exchange factor (GEF) 10-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL
Immunogen LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10521, KIAA1626
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HCE6
HTS Code 3002150000
Gene ID 55160
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARHGEF10L Antibody 25ul

Anti-ARHGEF10L Antibody 25ul